PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G366400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 304aa    MW: 34967.8 Da    PI: 7.1684
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G366400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.87.8e-161360148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEde+l d++ ++G g+W++ ++++g+ R +k+c++rw +yl
  Aqcoe2G366400.1.p 13 KGLWSPEEDEKLRDYIFRYGHGCWSSLPSRVGLQRNGKSCRLRWINYL 60
                       678*******************************************97 PP

2Myb_DNA-binding50.26e-1666109146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg +T +Ed+ ++ +++ lG++ W+ Ia+ ++ gRt++++k++w++
  Aqcoe2G366400.1.p  66 RGVFTSQEDQTILALHQSLGNR-WSQIAQQLP-GRTDNEIKNYWHS 109
                        899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.741860IPR017930Myb domain
SMARTSM007171.7E-121262IPR001005SANT/Myb domain
SuperFamilySSF466891.91E-2812107IPR009057Homeodomain-like
PfamPF002494.0E-141360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-221467IPR009057Homeodomain-like
CDDcd001675.04E-111660No hitNo description
PROSITE profilePS5129425.09261115IPR017930Myb domain
SMARTSM007172.8E-1465113IPR001005SANT/Myb domain
PfamPF002494.0E-1466110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-2668115IPR009057Homeodomain-like
CDDcd001671.21E-969108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MACDKSPKAM YRKGLWSPEE DEKLRDYIFR YGHGCWSSLP SRVGLQRNGK SCRLRWINYL  60
RPGLKRGVFT SQEDQTILAL HQSLGNRWSQ IAQQLPGRTD NEIKNYWHSC LKKKVMKAAE  120
GFQAQSNSQS PKTMESASSS HEPNNEVSSF KPFQSQEPYD HTKRSSLDPN YGTSRPKFFS  180
QGTNSKCFPK ILFSEWLTSS DHVNQQQNIN HSCNQMMLME NSDDSNVANI VSKYEDNSHD  240
DSSDVNFVYK QNFSHEIEQT VDELHHHELK NNGATMVSKF GLVDFVSTGE MYSDFNMYHD  300
LIY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26131157108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.11e-60myb domain protein 19